NUAK2 Recombinant monoclonal antibody, PBS Only (Detector)

NUAK2 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84849-4-PBS
Clone No.242220C1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA, Sample test

242220C1, ANPH2, EC:2.7.11.1, NUAK 2, NUAK family SNF1-like kinase 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84849-4-PBS targets NUAK2 as part of a matched antibody pair:

MP01626-3: 84849-2-PBS capture and 84849-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35302

Product name: Recombinant human NUAK2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 10005287 of NM_030952

Sequence: DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT

Predict reactive species
Full Name NUAK family, SNF1-like kinase, 2
Calculated Molecular Weight70kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberNM_030952
Gene Symbol NUAK2
Gene ID (NCBI) 81788
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9H093
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NUAK2, also known as OMPHK2 and SNARK, is the fourth member of the AMPK kinase family. The molecular mass of NUAK2 is 69 kDa and it plays a key role in neural tube closure during embryonic development (PMID: 32845958).

Loading...
||
New chat Able
正在加载,请稍候...