Product Information
84864-3-PBS targets Sodium iodide symporter as part of a matched antibody pair:
MP01665-1: 84864-3-PBS capture and 84864-1-PBS detection (validated in Cytometric bead array)
MP01665-2: 84864-3-PBS capture and 84864-2-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag19504 Product name: Recombinant human SLC5A5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 538-643 aa of BC105047 Sequence: TVLCGALISCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL Predict reactive species |
| Full Name | solute carrier family 5 (sodium iodide symporter), member 5 |
| Calculated Molecular Weight | 643 aa, 69 kDa |
| GenBank Accession Number | BC105047 |
| Gene Symbol | Sodium iodide symporter |
| Gene ID (NCBI) | 6528 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q92911 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
