TEAD4 Recombinant monoclonal antibody, PBS Only (Detector)

TEAD4 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84932-4-PBS
Clone No.242496B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

242496B2, EFTR 2, hRTEF 1B, RTEF1, TCF13L1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84932-4-PBS targets TEAD4 as part of a matched antibody pair:

MP01682-3: 84932-5-PBS capture and 84932-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3059

Product name: Recombinant human TEAD4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 135-434 aa of BC015497

Sequence: SAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Predict reactive species
Full Name TEA domain family member 4
Calculated Molecular Weight 434 aa, 48 kDa
Observed Molecular Weight50-55 kDa
GenBank Accession NumberBC015497
Gene Symbol TEAD4
Gene ID (NCBI) 7004
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15561
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TEAD4 belongs to a protein family that shares the TEA/ATTS domain. The transcriptional activity of TEAD4 required several regions of the proteins, a TBP-associated factor, and a limiting transcriptional intermediary factor. TEAD4 also performs an essential role in the Hippo signaling pathway. TEAD4 regulates gene expression of YAP1 and WWTR1/TAZ, thus mediating cell proliferation, migration, and epithelial-mesenchymal transition induction. The calculated molecular weight of TEAD4 is 48 kDa, but the molecular weight of TEAD4 is detected at about 50-55 kDa.

Loading...
||
New chat Able
正在加载,请稍候...