PLCG1 Recombinant monoclonal antibody, PBS Only (Capture)

PLCG1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84941-1-PBS
Clone No.242529A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1, 242529A11, EC:3.1.4.11, Phosphoinositide phospholipase C-gamma-1, Phospholipase C gamma 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84941-1-PBS targets PLCG1 as part of a matched antibody pair:

MP01700-3: 84941-1-PBS capture and 84941-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27218

Product name: Recombinant human PLCG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 467-563 aa of

Sequence: AEGSAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRDGRH

Predict reactive species
Full Name phospholipase C, gamma 1
Calculated Molecular Weight 149 kDa
Gene Symbol PLCG1
Gene ID (NCBI) 5335
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP19174
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Phosphoinositide phospholipase C-gamma-1 (PLCG1) which belongs to the phosphoinositide-specific phospholipase C (PLC) family, is activated by many extracellular stimuli including hormones, neurotransmitters, and growth factors and modulates several cellular and physiological functions necessary for tumorigeneses such as cell survival, migration, invasion, and angiogenesis by generating inositol 1,4,5-triphosphate (IP3) and diacylglycerol (DAG) via hydrolysis of phosphatidylinositol 4,5-biphosphate (PIP2) (PMID: 9242915). Phosphorylation is one of the key mechanisms that regulate the activity of PLC. PLCγ is activated by both receptor and non-receptor tyrosine kinases (PMID: 2472218). PLCγ forms a complex with EGF and PDGF receptors, which leads to the phosphorylation of PLCγ at Tyr771, 783, and 1248 (PMID: 1708307). It has also been shown that PKA-mediated phosphorylation at Ser1248 is inhibitory to PLCγ1 tyrosine phosphorylation and phospholipase activity in CD3-treated Jurkat cells (PMID: 1370476), suggesting that Ser1248 may be an allosteric regulator of PLCγ1 activity.

Loading...
||
New chat Able
正在加载,请稍候...