Use Able AI chat for product recommendations

USP33 Recombinant monoclonal antibody, PBS Only (Capture)

USP33 Uni-rAb® Recombinant Antibody for IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84958-1-PBS
Clone No.242535A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

242535A6, EC:3.4.19.12, hVDU1, KIAA1097, Ubiquitin carboxyl-terminal hydrolase 33

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84958-1-PBS targets USP33 as part of a matched antibody pair:

MP01703-3: 84958-1-PBS capture and 84958-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14268

Product name: Recombinant human USP33 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 290-472 aa of BC016663

Sequence: QVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQILPSNEGVNPRLSASPPKSGNLWPGLAPPHKKAQSASPKRKKQHKKYR

Predict reactive species
Full Name ubiquitin specific peptidase 33
Calculated Molecular Weight 942 aa, 107 kDa
GenBank Accession NumberBC016663
Gene Symbol USP33
Gene ID (NCBI) 23032
RRIDAB_3743885
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8TEY7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

USP33(Ubiquitin carboxyl-terminal hydrolase 33) is also named as KIAA1097, VDU1 and belongs to the peptidase C19 family. This protein, originally identified as a von Hippel-Lindau tumor suppressor (VHL) protein-interacting deubiquitinating enzyme, binds to the Robo1 receptor, and that USP33 is required for Slit responsiveness in breast cancer cells(PMID:19706539). The localization of USP33 is broadly confined to the secretory pathway, with all variants localizing to endoplasmic reticulum-associated structures(PMID:21801292). It has 3 isoforms produced by alternative splicing.

Loading...
||
New chat

Able

正在加载,请稍候...