• Featured Product
  • KD/KO Validated

ZNF618 Recombinant monoclonal antibody, PBS Only (Capture)

ZNF618 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 84998-1-PBS
Clone No.242566D9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

242566D9, KIAA1952, Zinc finger protein 618

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84998-1-PBS targets ZNF618 as part of a matched antibody pair:

MP01753-2: 84998-1-PBS capture and 84998-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag36487

Product name: Recombinant human ZNF618 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 200-382 aa of NM_001318042.1

Sequence: YSCFQEHRDLHAVDVFSVEGAPENRADPFDQGVVATDEVKEEPPEPFQKIGPKTGNYTCEFCGKQYKYYTPYQEHVALHAPISTAPGWEPPDDPDTGSECSHPEVSPSPRFVAAKTQTNQSGKKAPASVVRCATLLHRTPPATQTQTFRTPNSGSPASKATAAESAFSRRVEGKAQNHFEETN

Predict reactive species
Full Name zinc finger protein 618
Calculated Molecular Weight105kDa,954aa
Observed Molecular Weight110-130 kDa
GenBank Accession NumberNM_001318042.1
Gene Symbol ZNF618
Gene ID (NCBI) 114991
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ5T7W0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Zinc finger protein 618 (ZNF618) is a key protein associated with DNA methylation and acts as a specific 5hmC reader in vivo to regulate UHRF2 function by promoting UHRF2 chromatin localization. In addition, ZNF618 is not only associated with the induction, maintenance or progression of female breast cancer, but is also up-regulated in lung cancer cells.

Loading...
||
New chat Able
正在加载,请稍候...