TINAGL1 Recombinant monoclonal antibody, PBS Only (Detector)

TINAGL1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 85140-2-PBS
Clone No.242813F10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Oxidized LDL-responsive gene 2 protein, OLRG-2, LCN7, Glucocorticoid-inducible protein 5, ARG1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85140-2-PBS targets TINAGL1 as part of a matched antibody pair:

MP01822-1: 85140-1-PBS capture and 85140-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2721

Product name: Recombinant human TINAGL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-218 aa of BC009048

Sequence: MTPVLSPQNLLSCDTHQQQGCRGGRLDGAWWFLRRRGVVSDHCYPFSGRERDEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSNDKEIMKELMENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKYWTAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHH

Predict reactive species
Full Name tubulointerstitial nephritis antigen-like 1
Calculated Molecular Weight 467 aa, 52 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC009048
Gene Symbol TINAGL1
Gene ID (NCBI) 64129
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9GZM7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Tubulointerstitial nephritis antigen-like 1 (Tinagl1), a secreted extracellular protein, was initially identified as a putative component of the ECM. Tinagl1 is most commonly associated with embryonic development, including the heart and adrenal glands. Low levels of Tinagl1 expression can be dire for craniofacial development and for female fertility.

Loading...
||
New chat Able
正在加载,请稍候...