Filter: AllSandwich ELISA sample testSandwich ELISA

Sandwich ELISA sample test of MP03215-1
The mean CD151 concentration was determined to be 75.35 ng/mL in HepG2 cell extract based on a 1.20 mg/mL extract load, 40.21 ng/mL in Jurkat cell extract based on a 1.20 mg/mL extract load, 128.99 ng/mL in HeLa cell extract based on a 1.20 mg/mL extract load, 6.04 ng/mL in Daudi cell extract based on a 1.10 mg/mL extract load, 489.64 ng/mL in A431 cell extract based on a 1.50 mg/mL extract load and 19.76 ng/mL in A549 cell extract based on a 1.20 mg/mL extract load.
×
The mean CD151 concentration was determined to be 75.35 ng/mL in HepG2 cell extract based on a 1.20 mg/mL extract load, 40.21 ng/mL in Jurkat cell extract based on a 1.20 mg/mL extract load, 128.99 ng/mL in HeLa cell extract based on a 1.20 mg/mL extract load, 6.04 ng/mL in Daudi cell extract based on a 1.10 mg/mL extract load, 489.64 ng/mL in A431 cell extract based on a 1.50 mg/mL extract load and 19.76 ng/mL in A549 cell extract based on a 1.20 mg/mL extract load.
Sandwich ELISA standard curve of MP03215-1
Sandwich ELISA standard curve of MP03215-1, Human CD151 Recombinant Matched Antibody Pair - PBS only. 85385-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg3476. 85385-3-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL.

CD151 Recombinant monoclonal antibody, PBS Only (Capture)

Name: CD151 Recombinant monoclonal antibody, PBS Only (Capture)
Brand: Proteintech
SKU: 85385-4-PBS

CD151 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 85385-4-PBS

Clone No.252763H7

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

CD151 antigen, GP27, Membrane glycoprotein SFA 1, Membrane glycoprotein SFA-1, MER2

Formulation: PBS Only

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

85385-4-PBS targets CD151 as part of a matched antibody pair:

MP03215-1: 85385-4-PBS capture and 85385-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg3476 Product name: Recombinant Human CD151 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 113-221 aa of NM_004357.5 Sequence: AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR Predict reactive species
Full Name	CD151 molecule (Raph blood group)
Calculated Molecular Weight	28kDa
GenBank Accession Number	NM_004357.5
Gene Symbol	CD151
Gene ID (NCBI)	977
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P48509
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Sandwich ELISA sample test of MP03215-1

Sandwich ELISA standard curve of MP03215-1

CD151 Recombinant monoclonal antibody, PBS Only (Capture)

CD151 Uni-rAb® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

-/ -

Product Information

Able™

CD151 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Able^™