PEX1 Recombinant monoclonal antibody, PBS Only (Capture)

PEX1 Uni-rAb® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 85429-1-PBS
Clone No.242994C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

EC:3.6.4.-, Peroxin 1, Peroxin-1, Peroxisomal ATPase PEX1, Peroxisome biogenesis factor 1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85429-1-PBS targets PEX1 as part of a matched antibody pair:

MP01946-1: 85429-1-PBS capture and 85429-3-PBS detection (validated in Cytometric bead array)

MP01946-2: 85429-1-PBS capture and 85429-2-PBS detection (validated in Cytometric bead array)

MP01946-3: 85429-1-PBS capture and 85429-5-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4623

Product name: Recombinant human PEX1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 927-1283 aa of BC035575

Sequence: IRAQAAKPCILFFDEFESIAPRRGHDNTGVTDRVVNQLLTQLDGVEGLQGVYVLAATSRPDLIDPALLRPGRLDKCVYCPPPDQVSRLEILNVLSDSLPLADDVDLQHVASVTDSFTGADLKALLYNAQLEALHGMLLSSGLQDGSSSSDSDLSLSSMVFLNHSSGSDDSAGDGECGLDQSLVSLEMSEILPDESKFNMYRLYFGSSYESELGNGTSSDLSSQCLSAPSSMTQDLPGVPGKDQLFSQPPVLRTASQEGCQELTQEQRDQLRADISIIKGRYRSQSGEDESMNQPGPIKTRLAISQSHLMTALGHTRPSISEDDWKNFAELYESFQNPKRRKNQSGTMFRPGQKVTLA

Predict reactive species
Full Name peroxisomal biogenesis factor 1
Calculated Molecular Weight 1283 aa, 143 kDa
GenBank Accession NumberBC035575
Gene Symbol PEX1
Gene ID (NCBI) 5189
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO43933
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...