VRK1 Recombinant monoclonal antibody, PBS Only (Detector)

VRK1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 85598-2-PBS
Clone No.242978A1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

EC:2.7.11.1, Serine/threonine-protein kinase VRK1, Vaccinia-related kinase 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85598-2-PBS targets VRK1 as part of a matched antibody pair:

MP01967-1: 85598-3-PBS capture and 85598-2-PBS detection (validated in Cytometric bead array)

MP01967-2: 85598-1-PBS capture and 85598-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27754

Product name: Recombinant human VRK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 262-396 aa of BC103761

Sequence: EDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK

Predict reactive species
Full Name vaccinia related kinase 1
Calculated Molecular Weight 396 aa, 45 kDa
Observed Molecular Weight 45-50 kDa
GenBank Accession NumberBC103761
Gene Symbol VRK1
Gene ID (NCBI) 7443
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99986
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Vaccinia-related kinase 1 (VRK1) is a members of the vaccinia-related kinase (VRK) family of serine/threonine kinases and are principally localized in the nucleus. VRK1 was initially described as a kinase with homology to B1R, a vaccinia virus kinase required for viral DNA replication and the early phase of infection. It has been suggested that VRK1 was overexpressed in numerous human tumors, such as lung carcinomas, hepatocellular carcinoma, breast carcinomas, head and neck squamous cell carcinoma. (PMID: 28927264, PMID: 29103766)

Loading...
||
New chat Able
正在加载,请稍候...