LIPA Recombinant monoclonal antibody, PBS Only (Detector)

LIPA Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 85607-1-PBS
Clone No.243025C11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

CESD, Cholesteryl esterase, EC:3.1.1.13, Lipase A, LipaseA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85607-1-PBS targets LIPA as part of a matched antibody pair:

MP01970-2: 85607-3-PBS capture and 85607-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3627

Product name: Recombinant human LIPA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 15-200 aa of BC012287

Sequence: WPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFAL

Predict reactive species
Full Name lipase A, lysosomal acid, cholesterol esterase
Calculated Molecular Weight 399 aa, 45 kDa
Observed Molecular Weight45-50 kDa
GenBank Accession NumberBC012287
Gene Symbol LIPA
Gene ID (NCBI) 3988
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP38571
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Human acid lipase/cholesteryl esterase (LIPA) is a 46-kDa glycoprotein required for the lysosomal hydrolysis of cholesteryl esters and triglycerides that cells acquire through the receptor-mediated endocytosis of low-density lipoproteins(PMID:8432549). Defects in LIPA are the cause of Wolman disease (WOD)(PMID:8146180) and cholesteryl ester storage disease (CESD)(PMID:9633819). It has 2 isoforms produced by alternative splicing with the molecular weight of 45 kDa and 39 kDa. The full length protein has a signal peptide and several glycosylation sites.

Loading...
||
New chat

Able

正在加载,请稍候...