RPA1 Recombinant monoclonal antibody, PBS Only (Detector)

RPA1 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 85633-4-PBS
Clone No.243082C12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

POLR1A, A190, DNA-directed RNA polymerase I largest subunit, DNA-directed RNA polymerase I subunit A, DNA-directed RNA polymerase I subunit RPA1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85633-4-PBS targets RPA1 as part of a matched antibody pair:

MP02120-1: 85633-5-PBS capture and 85633-4-PBS detection (validated in Cytometric bead array)

MP02120-2: 85633-3-PBS capture and 85633-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14543

Product name: Recombinant human RPA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 295-574 aa of BC017115

Sequence: DDEDMQEERNPHREGARKTQEQDEEVGLGTEEDPSLPALLTQPRKPTHSQEPQGPEAMERRVQAVREIHPFIDDYQYDTEESLWCQVTVKLPLMKINFDMSSLVVSLAHGAVIYATKGITRCLLNETTNNKNEKELVLNTEGINLPELFKYAEVLDLRRLYSNDIHAIANTYGIEAALRVIEKEIKDVFAVYGIAVDPRHLSLVADYMCFEGVYKPLNRFGIRSNSSPLQQMTFETSFQFLKQATMLGSHDELRSPSACLVVGKVVRGGTGLFELKQPLR

Predict reactive species
Full Name polymerase (RNA) I polypeptide A, 194kDa
Calculated Molecular Weight 1720 aa, 195 kDa
GenBank Accession NumberBC017115
Gene Symbol POLR1A
Gene ID (NCBI) 25885
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95602
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...