BZW1 Recombinant monoclonal antibody, PBS Only (Detector)

BZW1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 85655-1-PBS
Clone No.243162H4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

5MP2, Basic leucine zipper and W2 domain-containing protein 1, BZAP45, eIF5-mimic protein 2, KIAA0005

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85655-1-PBS targets BZW1 as part of a matched antibody pair:

MP02022-1: 85655-3-PBS capture and 85655-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13830

Product name: Recombinant human BZW1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 143-273 aa of BC001804

Sequence: SESERNKLAMLTGVLLANGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVSMDNRLMELFPANKQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKD

Predict reactive species
Full Name basic leucine zipper and W2 domains 1
Calculated Molecular Weight 353 aa, 41 kDa
Observed Molecular Weight45 kDa
GenBank Accession NumberBC001804
Gene Symbol BZW1
Gene ID (NCBI) 9689
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ7L1Q6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BZW1, also known as basic leucine zipper and W2 domains 1, is a member of the basic leucine zipper (bZIP) superfamily of transcription factors. It is a 45 kDa protein that contains an N-terminal bZIP domain for protein interactions and a C-terminal nucleotide (ATP or GTP) binding domain. Human BZW1 can activate transcription of the histone H4 gene and serve as a co-regulator with other transcription factors to control the cell cycle. In recent years, BZW1 has been identified as enhancing phosphorylation to promote glycolysis in pancreatic ductal adenocarcinoma. Moreover, BZW1 has been found to regulate the cell cycle in ovarian cancer, thereby promoting its progression. Additionally, BZW1 plays a crucial role in mucoepidermoid carcinoma of the salivary glands. BZW1 is also involved in the regulation of translation initiation, acting as a translational rheostat and autoregulating its own translation. It has been suggested that BZW1, as well as its paralog BZW2, is an eIF5-mimic protein. BZW1 has been shown to facilitate glycolysis and promote tumor growth in pancreatic ductal adenocarcinoma through potentiating eIF2α phosphorylation, and it may serve as a therapeutic target for patients with pancreatic cancer. In macrophages, activation of BZW1 by CEBPB promotes eIF2α phosphorylation-mediated metabolic reprogramming and endoplasmic reticulum stress. BZW1 has also been found to be associated with the Wnt/β-catenin pathway in lung adenocarcinoma, potentially influencing epithelial-mesenchymal transition (EMT) processes.

Loading...
||
New chat

Able

正在加载,请稍候...