SMR3B Recombinant monoclonal antibody, PBS Only (Capture)

SMR3B Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 85745-3-PBS
Clone No.242868D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

P B, PBII, PRL3, PROL3, Proline rich peptide P B

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85745-3-PBS targets SMR3B as part of a matched antibody pair:

MP02114-1: 85745-3-PBS capture and 85745-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3081

Product name: Recombinant Human SMR3B protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 23-79 aa of NM_006685.4

Sequence: QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP

Predict reactive species
Full Name submaxillary gland androgen regulated protein 3B
Calculated Molecular Weight8 kDa
Observed Molecular Weight8 kDa
GenBank Accession NumberNM_006685.4
Gene Symbol SMR3B
Gene ID (NCBI) 10879
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02814
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SMR3B is an androgen-regulated secreted PRP-family peptide produced primarily in the submandibular and sublingual glands. Released into saliva, it contributes to lubrication, oral defense, and glandular homeostasis. Highly tissue-specific, SMR3B serves as a marker of salivary gland function and is altered in xerostomia, Sjögren's syndrome, and head-and-neck cancers, highlighting its relevance in secretory physiology and disease.

Loading...
||
New chat

Able

正在加载,请稍候...