Use Able AI chat for product recommendations

Mouse CCL19/MIP-3 beta Recombinant monoclonal antibody, PBS Only (Detector)

CCL19/MIP-3 beta Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 85861-1-PBS
Clone No.242867C1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

C-C motif chemokine 19, Ccl19, EBI1 ligand chemokine, ELC, Epstein-Barr virus-induced molecule 1 ligand chemokine

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85861-1-PBS targets CCL19/MIP-3 beta as part of a matched antibody pair:

MP02165-1: 85861-3-PBS capture and 85861-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3124

Product name: Recombinant Mouse CCL19/MIP-3 beta protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 26-108 aa of NM_011888.2

Sequence: GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS

Predict reactive species
Full Name chemokine (C-C motif) ligand 19
Calculated Molecular Weight12 kDa
GenBank Accession NumberNM_011888.2
Gene Symbol Ccl19
Gene ID (NCBI) 24047
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO70460
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CCL19, also known as MIP-3β, is one of several CC cytokine genes clustered on the p-arm of chromosome 9. CCL19 may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7.

Loading...
||
New chat

Able

正在加载,请稍候...