Mouse Cathepsin D Recombinant monoclonal antibody, PBS Only (Detector)

Cathepsin D Uni-rAb® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA
Cat No. 85964-1-PBS
Clone No.250329A3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA

Cathepsin D heavy chain, Cathepsin D light chain, CLN10, CPSD, CTSD

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85964-1-PBS targets Cathepsin D as part of a matched antibody pair:

MP02204-2: 85964-4-PBS capture and 85964-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2986

Product name: Recombinant Mouse Cathepsin D protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 21-410 aa of NM_009983.3

Sequence: IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL

Predict reactive species
Full Name cathepsin D
Calculated Molecular Weight45 kDa
Observed Molecular Weight46 kDa, 28 kDa
GenBank Accession NumberNM_009983.3
Gene Symbol Ctsd
Gene ID (NCBI) 13033
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP18242
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CTSD (Cathepsin D) also named CPSD, is a representative aspartic proteinase in lysosomes and is widely distributed in various tissue cells of mammals. The expression level of CTSD varies depending on the tissue, whereas neurons in CNS tissues possess abundant CTSD. CTSD is synthesized as a 52-kDa precursor that is converted into an active ~48-kDa single-chain intermediate in the endosomes, and then into a fully active mature form, composed of a 28-kDa heavy chain and a 14-kDa light chain, in the lysosomes (PMID: 10995834, PMID: 7641679, PMID: 30051532).

Loading...
||
New chat Able
正在加载,请稍候...