Cathepsin D Recombinant monoclonal antibody

• 

  WB analysis using 85964-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85964-1-RR (Cathepsin D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of NIH/3T3 using 85964-1-RR

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using Cathepsin D antibody (85964-1-RR, Clone: 250329A3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

Cathepsin D Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 85964-1-RR

Clone No.250329A3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IF/ICC, ELISA

Synonyms

Cathepsin D heavy chain, Cathepsin D light chain, CLN10, CPSD, CTSD

---

Tested Applications

• Positive WB detected in: Neuro-2a cells, RAW 264.7 cells, NIH/3T3 cells
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85964-1-RR targets Cathepsin D in WB, IF/ICC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2986

  Product name: Recombinant Mouse Cathepsin D protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 21-410 aa of NM_009983.3

  Sequence: IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL

• Full Name: cathepsin D
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 46 kDa, 28 kDa
• GenBank Accession Number: NM_009983.3
• Gene Symbol: Ctsd
• Gene ID (NCBI): 13033
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P18242
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CTSD (Cathepsin D) also named CPSD, is a representative aspartic proteinase in lysosomes and is widely distributed in various tissue cells of mammals. The expression level of CTSD varies depending on the tissue, whereas neurons in CNS tissues possess abundant CTSD. CTSD is synthesized as a 52-kDa precursor that is converted into an active ~48-kDa single-chain intermediate in the endosomes, and then into a fully active mature form, composed of a 28-kDa heavy chain and a 14-kDa light chain, in the lysosomes (PMID: 10995834, PMID: 7641679, PMID: 30051532).