HMGCR Recombinant monoclonal antibody, PBS Only (Detector)

HMGCR Uni-rAb® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 86005-1-PBS
Clone No.243065E2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

EC:1.1.1.34, HMG CoA reductase, HMG-CoA reductase

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86005-1-PBS targets HMGCR as part of a matched antibody pair:

MP02239-1: 86005-2-PBS capture and 86005-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4444

Product name: Recombinant human HMGCR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 536-835 aa of BC033692

Sequence: TRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA

Predict reactive species
Full Name 3-hydroxy-3-methylglutaryl-Coenzyme A reductase
Calculated Molecular Weight 888 aa, 95 kDa
GenBank Accession NumberBC033692
Gene Symbol HMGCR
Gene ID (NCBI) 3156
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04035
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...