CD74 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

CD74 Uni-rAb® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 86023-1-PBS
Clone No.250520A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Class-II-associated invariant chain peptide, DHLAG, HLADG, HLA-DR antigens-associated invariant chain, Ia antigen-associated invariant chain

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86023-1-PBS targets CD74 as part of a matched antibody pair:

MP02221-1: 86023-2-PBS capture and 86023-1-PBS detection (validated in Cytometric bead array)

MP02221-2: 86023-1-PBS capture and 86023-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1945

Product name: Recombinant Human CD74 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 73-232 aa of NM_001025159.3

Sequence: QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Predict reactive species
Full Name CD74 molecule, major histocompatibility complex, class II invariant chain
Calculated Molecular Weight26 kDa
GenBank Accession NumberNM_001025159.3
Gene Symbol CD74
Gene ID (NCBI) 972
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04233-2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...