ALOX15B Recombinant monoclonal antibody, PBS Only (Capture)

ALOX15B Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA, Sample test
Cat No. 86146-1-PBS
Clone No.250442C5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA, Sample test

15 lipoxygenase 2, 15 LO 2, 15 LOX 2, 15 LOX B, 15-lipoxygenase 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86146-1-PBS targets ALOX15B as part of a matched antibody pair:

MP02510-1: 86146-1-PBS capture and 86146-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3741

Product name: Recombinant human ALOX15B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC035217

Sequence: MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKW

Predict reactive species
Full Name arachidonate 15-lipoxygenase, type B
Calculated Molecular Weight 676 aa, 76 kDa
Observed Molecular Weight 67-75 kDa
GenBank Accession NumberBC035217
Gene Symbol ALOX15B
Gene ID (NCBI) 247
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15296
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

In humans, there are 6 functional lipoxygenases genes. Two of them encode for arachidonic acid 12-lipoxygenating (ALOX12, ALOX12B) and two for 15-lipoxygenating enzymes (ALOX15, ALOX15B). ALOX15B has been described as the most abundant 15-lipoxygenating enzyme species in human carotid atherosclerotic lesions and to be associated with cerebrovascular symptoms. (PMID:24373925).

Loading...
||
New chat

Able

正在加载,请稍候...