CDK5RAP3 Recombinant monoclonal antibody, PBS Only (Detector)

CDK5RAP3 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 86177-1-PBS
Clone No.250801G6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

C53, CDK5 activator-binding protein C53, CDK5 regulatory subunit-associated protein 3, HSF 27, HSF27

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86177-1-PBS targets CDK5RAP3 as part of a matched antibody pair:

MP02384-1: 86177-3-PBS capture and 86177-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1474

Product name: Recombinant human CDK5RAP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-300 aa of BC009957

Sequence: MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPES

Predict reactive species
Full Name CDK5 regulatory subunit associated protein 3
Calculated Molecular Weight 57 kDa
Observed Molecular Weight 65 kDa
GenBank Accession NumberBC009957
Gene Symbol CDK5RAP3
Gene ID (NCBI) 80279
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96JB5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Cyclin-dependent kinase 5 (CDK5) regulatory subunit associated protein 3 (CDK5RAP3, also named as C53 or LZAP) was initially identified as a binding protein of CDK5 activator p35. CDK5RAP3 is widely expressed in human tissues and broadly located in subcellular compartments. By interacting with other proteins, CDK5RAP3 participates in the regulation of multiple cellular processes including cell cycle, apoptosis, cell invasion, signaling transduction, autophagy, UFMylation and endoplasmic reticulum (ER) stress.

Loading...
||
New chat

Able

正在加载,请稍候...