FKBP5 Recombinant monoclonal antibody

FKBP5 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 86189-1-RR
Clone No.250798G2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

FKBP-51, 51 kDa FK506-binding protein, 54 kDa progesterone receptor-associated immunophilin, AIG6, Androgen-regulated protein 6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, K-562 cells, Jurkat cells, SH-SY5Y cells, mouse thymus tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86189-1-RR targets FKBP5 in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5337

Product name: Recombinant human FKBP5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-375 aa of BC042605

Sequence: MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE

Predict reactive species
Full Name FK506 binding protein 5
Calculated Molecular Weight 457 aa, 51 kDa
Observed Molecular Weight51 kDa
GenBank Accession NumberBC042605
Gene Symbol FKBP5
Gene ID (NCBI) 2289
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13451
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FKBP5, also known as FKBP51, belongs to the family of immunophilins, FK506 binding proteins (FKBPs). FKBP5 is a negative regulator of GR activity and plays a key role in the termination of the stress response by GRs. FKBP5 limits GR function by decreasing ligand-binding sensitivity, thereby delaying nuclear translocation and reducing GR-dependent transcriptional activity. The known functions of FKBP5 include the regulation of steroid hormone receptors, inhibiting apoptosis in cancer cells, promoting Akt1 dephosphorylation, and inhibiting the Akt1 pathways, to name a few. FKBP5 is widely expressed and the calculated molecular weight is 51 kDa (PMID: 21119664, PMID: 34077736, PMID: 37154033).

Protocols

Product Specific Protocols
WB protocol for FKBP5 antibody 86189-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...