Mouse CD107a / LAMP1 Recombinant monoclonal antibody, PBS Only (Capture)

CD107a / LAMP1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 86337-2-PBS
Clone No.250972C12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

CD107a, Lamp1, Lamp 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86337-2-PBS targets CD107a / LAMP1 as part of a matched antibody pair:

MP02362-1: 86337-2-PBS capture and 86337-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3858

Product name: Recombinant Mouse LAMP-1/CD107a protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 25-370 aa of NM_010684.3

Sequence: LFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNN

Predict reactive species
Full Name lysosomal-associated membrane protein 1
Calculated Molecular Weight44 kDa
Observed Molecular Weight90-120 kDa
GenBank Accession NumberNM_010684.3
Gene Symbol CD107a
Gene ID (NCBI) 16783
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11438
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

LAMP1 (CD107a) is a heavily glycosylated membrane protein enriched in the lysosomal membrane. LAMP1 is extensively glycosylated with asparagine-linked oligosaccharides which protect it from intracellular proteolysis (PMID: 10521503). Although LAMP1 is expressed largely in the endosome-lysosomal membrane of cells, it is also found on the plasma membrane (PMID: 16168398). Elevated LAMP1 expression at the cell surface has also been detected during platelet and granulocytic cell activation, as well as in some tumor cells (PMID: 29085473). LAMP1 functions to provide selectins with carbohydrate ligands. This protein has also been shown to be a marker of degranulation on lymphocytes such as CD8+ and NK cells and may also play a role in tumor cell differentiation and metastasis (PMID: 18835598; 29085473; 9426697).

Loading...
||
New chat Able
正在加载,请稍候...