COQ7 Recombinant monoclonal antibody, PBS Only (Detector)

COQ7 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 86394-1-PBS
Clone No.251065A2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

CAT5, CLK1, EC:1.14.99.60, Timing protein clk-1 homolog, Ubiquinone biosynthesis monooxygenase COQ7

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86394-1-PBS targets COQ7 as part of a matched antibody pair:

MP02418-1: 86394-2-PBS capture and 86394-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7161

Product name: Recombinant human COQ7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-217 aa of BC003185

Sequence: MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL

Predict reactive species
Full Name coenzyme Q7 homolog, ubiquinone (yeast)
Calculated Molecular Weight 24 kDa
Observed Molecular Weight20~24 kDa
GenBank Accession NumberBC003185
Gene Symbol COQ7
Gene ID (NCBI) 10229
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99807
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

COQ7(Ubiquinone biosynthesis protein COQ7 homolog) catalyzes the production of coenzyme Q (CoQ) in mitochondria. The predicted protein contains 179 amino acids, is mostly helical, and contains an alpha-helical membrane insertion. It has a potential N-glycosylation site, a phosphorylation site for protein kinase C and another for casein kinase II, and 3 N-myristoylation sites. This protein has 2 isoforms produced by alternative splicing with MW 20-24 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...