GSTA2 Recombinant monoclonal antibody, PBS Only (Capture)

GSTA2 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 86428-3-PBS
Clone No.251223E2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

EC:2.5.1.18, Glutathione S-transferase A2, GST class-alpha member 2, GST gamma, GST HA subunit 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86428-3-PBS targets GSTA2 as part of a matched antibody pair:

MP02440-1: 86428-3-PBS capture and 86428-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0781

Product name: Recombinant human GSTA2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-222 aa of BC002895

Sequence: MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF

Predict reactive species
Full Name glutathione S-transferase alpha 2
Calculated Molecular Weight 26 kDa
Observed Molecular Weight26 kDa
GenBank Accession NumberBC002895
Gene Symbol GSTA2
Gene ID (NCBI) 2939
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP09210
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. Glutathione S-transferase A2 (GSTA2) which is a phase II detoxifying enzyme is highly expressed in the liver tissue functioning in detoxification of electrophilic compounds, such as products of oxidative stress.

Loading...
||
New chat

Able

正在加载,请稍候...