Use Able AI chat for product recommendations

Peroxiredoxin 2 Recombinant monoclonal antibody, PBS Only (Detector)

Peroxiredoxin 2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 86599-1-PBS
Clone No.251494D3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

PRDX2, EC:1.11.1.24, Natural killer cell-enhancing factor B, NKEFB, NKEF-B

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86599-1-PBS targets Peroxiredoxin 2 as part of a matched antibody pair:

MP02542-1: 86599-2-PBS capture and 86599-1-PBS detection (validated in Cytometric bead array)

MP02542-2: 86599-3-PBS capture and 86599-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0835

Product name: Recombinant human PRDX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-198 aa of BC003022

Sequence: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Predict reactive species
Full Name peroxiredoxin 2
Calculated Molecular Weight 22 kDa
Observed Molecular Weight22 kDa
GenBank Accession NumberBC003022
Gene Symbol peroxiredoxin 2
Gene ID (NCBI) 7001
RRIDAB_3744995
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP32119
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Peroxiredoxin 2 (PRDX2), also named as TSA, PRP, NKEFB and TDPX1, belongs to the ahpC/TSA family. It is known to act as an antioxidant enzyme whose main function is H2O2 reduction in cells. PRDX2 is involved in redox regulation of the cell. It reduces peroxides with reducing equivalents provided through the thioredoxin system. It may play an important role in eliminating peroxides generated during metabolism. PRDX2 might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. PRDX2 actions may be related to the expression of NFKB and IKB.(PMID:21248284)

Loading...
||
New chat

Able

正在加载,请稍候...