Use Able AI chat for product recommendations

BUB1 Recombinant monoclonal antibody, PBS Only (Detector)

BUB1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA

Cat No. 86843-4-PBS
Clone No.251580E5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA

BUB1A, BUB1L, EC:2.7.11.1, hBUB1, Mitotic checkpoint serine/threonine-protein kinase BUB1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86843-4-PBS targets BUB1 as part of a matched antibody pair:

MP02812-1: 86843-5-PBS capture and 86843-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4138

Product name: Recombinant human BUB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 785-1083 aa of BC028201

Sequence: KLVYVHHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMERLKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMRMLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGTIFTAKCETSGFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFRRLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLECKRS

Predict reactive species
Full Name budding uninhibited by benzimidazoles 1 homolog (yeast)
Calculated Molecular Weight 1085 aa, 122 kDa
Observed Molecular Weight120-130 kDa
GenBank Accession NumberBC028201
Gene Symbol BUB1
Gene ID (NCBI) 699
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO43683
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Bub1 is an evolutionarily conserved mitotic checkpoint control protein that is present in diverse organisms including yeast and humans. Bub1 is a serine/threonine protein kinase and is required for recruitment of Mad1, Mad2, Bub3, and CENP-E to kinetochores. Full-length Bub1 protein was cleaved to an 45 kDa fragment and an intermediate fragment of 90 kDa, only detected at early stages of apoptosis execution, indicating cleavage of Bub1 in the amino- and carboxy-terminal regions of the protein(PMID:15818396).

Loading...
||
New chat

Able

正在加载,请稍候...