Use Able AI chat for product recommendations

DNAJA2 Recombinant monoclonal antibody, PBS Only (Capture)

DNAJA2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 87041-2-PBS
Clone No.252019B10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

CPR3, Dj3, DJA2, DNAJ, Dnj3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87041-2-PBS targets DNAJA2 as part of a matched antibody pair:

MP02847-1: 87041-2-PBS capture and 87041-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2877

Product name: Recombinant human DNAJA2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-214 aa of BC015809

Sequence: MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEV

Predict reactive species
Full Name DnaJ (Hsp40) homolog, subfamily A, member 2
Calculated Molecular Weight 417 aa, 46 kDa
Observed Molecular Weight46 kDa
GenBank Accession NumberBC015809
Gene Symbol DNAJA2
Gene ID (NCBI) 10294
RRIDAB_3745295
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO60884
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DNAJA2, also named as CPR3, HIRIP4, and DNJ-14, belongs to the DNAJ/Hsp40 family of proteins. DNAJA2 is a key regulator of protein homeostasis that stimulates the ATPase activity of Hsp70 chaperones, thereby facilitating protein folding, assembly, translocation, and degradation. DNAJA2 has a molecular mass of approximately 45 kDa and contains a highly conserved J-domain essential for its interaction with Hsp70. It can be detected as a band around 45 kDa in various human cell lines.

Loading...
||
New chat

Able

正在加载,请稍候...