Filter: AllWBSandwich ELISA sample testSandwich ELISAIF/ICCCytometric bead array sample testCytometric bead arrayAffinity

WB analysis using 87171-1-RR (same clone as 87171-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 87171-1-RR (COIL antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87171-1-PBS in a different storage buffer formulation.
WB analysis using 87171-1-RR (same clone as 87171-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 87171-1-RR (COIL antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87171-1-PBS in a different storage buffer formulation.
Sandwich ELISA sample test of MP02891-1
The mean Coilin concentration was determined to be 19.9 ng/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load and 9.6 ng/mL in Jurkat cell extract based on a 1.2 mg/mL extract load.
Sandwich ELISA standard curve of MP02891-1
Sandwich ELISA standard curve of MP02891-1, Human Coilin Recombinant Matched Antibody Pair - PBS only. 87171-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag1416. 87171-1-PBS was HRP conjugated as the detection antibody. Range: 39.1-2500 pg/mL.
IF Staining of HepG2 using 87171-1-RR (same clone as 87171-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COIL antibody (87171-1-RR, Clone: 252327B11 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 87171-1-PBS in a different storage buffer formulation.
Cytometric bead array sample test of MP02891-1
The mean COIL/Coilin concentration was determined to be 63.3 ng/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load, 29.8 ng/mL in Jurkat cell extract based on a 1.2 mg/mL extract load, 88.3 ng/mL in K-562 cell extract based on a 1.2 mg/mL extract load.
Cytometric bead array standard curve of MP02891-1
Cytometric bead array standard curve of MP02891-1, COIL/Coilin Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87171-2-PBS. Detection antibody: 87171-1-PBS. Standard: Ag1416. Range: 0.312-40 ng/mL.
Affinity of 87171-1-RR
Biolayer interferometry (BLl) kinetic assays of 87171-1-RR against Human Coilin were performed. The affinity constant is below 1 pM.

Coilin Recombinant monoclonal antibody, PBS Only (Detector)

Name: Coilin Recombinant monoclonal antibody, PBS Only (Detector)
Brand: Proteintech
SKU: 87171-1-PBS

Coilin Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 87171-1-PBS

Clone No.252327B11

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

COIL, CLN80, p80 coilin, p80-coilin

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

87171-1-PBS targets Coilin as part of a matched antibody pair:

MP02891-1: 87171-2-PBS capture and 87171-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag1416 Product name: Recombinant human COIL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 212-576 aa of BC010385 Sequence: ANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA Predict reactive species
Full Name	coilin
Calculated Molecular Weight	576 aa, 63 kDa
Observed Molecular Weight	75 kDa
GenBank Accession Number	BC010385
Gene Symbol	COIL
Gene ID (NCBI)	8161
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P38432
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

The nuclear coiled body(CBs) and nuclear structures known as gems contain high concentrations of the survival motor neurons (SMN) protein complex. CBs and gems often colocalize, and communication between them is mediated by COIL. COIL is a component of the CBS which are involved in the function or assembly/disassembly of nucleoplasmic snRNPs. During mitosis, CBs disassemble, coinciding with a mitotic-specific phosphorylation of p80 coilin, and symmetrical dimethylation of the COIL RG box motif is a molecular switch that determines whether the SMN complex forms gems or becomes incorporated into CBs.