Use Able AI chat for product recommendations

MYOT Recombinant monoclonal antibody, PBS Only (Capture)

MYOT Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 87334-1-PBS
Clone No.252646B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, Cytometric bead array, Indirect ELISA

Myofibrillar titin-like Ig domains protein, Myotilin, TTID

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87334-1-PBS targets MYOT as part of a matched antibody pair:

MP02976-1: 87334-1-PBS capture and 87334-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg6068

Product name: Recombinant human MYOTI protein

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 1-498 aa of /

Sequence: MFNYERPKHFIQSQNPCGSRLQPPGPETSSFSSQTKQSSIIIQPRQCTEQRFSASSTLSSHITMSSSAFPASPKQHAGSNPGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDSNYQQSSAGQPINAKPSQTANAKPIPRTPDHEIQGSKEALIQDLERKLKCKDTLLHNGNQRLTYEEKMARRLLGPQNAAAVFQAQDDSGAQDSQQHNSEHARLQVPTSQVRSRSTSRGDVNDQDAIQEKFYPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQSGLYESEEL

Predict reactive species
Full Name myotilin
Calculated Molecular Weight55 kDa
Observed Molecular Weight 55-57 kDa
GenBank Accession Number/
Gene Symbol MYOT
Gene ID (NCBI) 9499
RRIDAB_3745474
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UBF9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MYOT (myotilin) is a structural protein of the striated muscle Z-discs. It interacts with both actinin and filamin, forming a complex to maintain structural stability of muscles. In adult tissues, myotilin is mainly expressed in skeletal and cardiac muscles and in the peripheral nerves. Missense mutations of myotilin cause limb girdle muscular dystrophy 1A and some other myopathy.

Loading...
||
New chat

Able

正在加载,请稍候...