VHL Recombinant monoclonal antibody, PBS Only (Capture)

VHL Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 87374-3-PBS
Clone No.251968A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Protein G7, pVHL, RCA1, VHL 1, VHL1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87374-3-PBS targets VHL as part of a matched antibody pair:

MP02982-1: 87374-3-PBS capture and 87374-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg6405

Product name: Recombinant human VHL protein

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 1-213 aa of NM_000551.4

Sequence: MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Predict reactive species
Full Name von Hippel-Lindau tumor suppressor
Calculated Molecular Weight24 kDa
Observed Molecular Weight18-24 kDa
GenBank Accession NumberNM_000551.4
Gene Symbol VHL
Gene ID (NCBI) 7428
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP40337
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

VHL (von Hippel-Lindau tumor suppressor) gene was identified as the tumor suppressor gene whose germ line mutations are associated with the inherited von Hippel-Lindau cancer syndrome (PMID: 8603073, 10722748). VHL patients develop a wide variety of tumors including retinal angioma, central nervous system hemangioblastoma, pheochromocytoma, and renal clear cell carcinoma (PMID: 10722748). VHL localizes predominantly to the cytoplasmic compartment but engages in a dynamic nuclear-cytoplasmic shuttle (PMID: 8700833, 9891082, 12101228). VHL has isoforms with the molecular mass of 18-24 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...