Use Able AI chat for product recommendations

AP1B1 Recombinant monoclonal antibody, PBS Only (Detector)

AP1B1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, IP, Cytometric bead array, Indirect ELISA

Cat No. 87859-2-PBS
Clone No.253524D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Cytometric bead array, Indirect ELISA

Adaptor protein complex AP-1 subunit beta-1, Adaptor-related protein complex 1 subunit beta-1, ADTB1, AP 1 complex subunit beta 1, AP-1 complex subunit beta-1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87859-2-PBS targets AP1B1 as part of a matched antibody pair:

MP03244-1: 87859-3-PBS capture and 87859-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10417

Product name: Recombinant human AP1B1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 671-919 aa of BC046242

Sequence: NFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPKAVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSCTLSLKCRAPEVSQHVYQAYETILKN

Predict reactive species
Full Name adaptor-related protein complex 1, beta 1 subunit
Calculated Molecular Weight 919 aa, 101 kDa
Observed Molecular Weight 101 kDa
GenBank Accession NumberBC046242
Gene Symbol AP1B1
Gene ID (NCBI) 162
RRIDAB_3745793
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ10567
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

AP1B1 is a subunit of the adaptor complex AP-1 and is a member of the adaptin protein family. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors.

Loading...
||
New chat

Able

正在加载,请稍候...