Home
Products
Primary Antibodies
Recombinant Antibodies
CXCL13/BCA1 Recombinant monoclonal antibody (87928-3-RR)

CXCL13/BCA1 Recombinant monoclonal antibody

CXCL13/BCA1 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 87928-3-RR

Clone No.253456A10

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

CXCL13, B cell-attracting chemokine 1, BCA 1, BCA1, BCA-1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of TT using 87928-3-RR
TT cells were subjected to SDS PAGE followed by western blot with 87928-3-RR (CXCL13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 87928-3-RR
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 87928-3-RR (CXCL13 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 87928-3-RR
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 87928-3-RR (CXCL13 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	TT cells
Positive IHC detected in	human tonsillitis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

87928-3-RR targets CXCL13/BCA1 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg7258 Product name: Recombinant human CXCL13 protein Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 23-109 aa of NM_006419.2 Sequence: VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP Predict reactive species
Full Name	chemokine (C-X-C motif) ligand 13
Calculated Molecular Weight	13 kDa
Observed Molecular Weight	13 kDa
GenBank Accession Number	NM_006419.2
Gene Symbol	CXCL13/BCA1
Gene ID (NCBI)	10563
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q53X90
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CXCL13 (C-X-C motif chemokine ligand 13), also known as B cell-attracting chemokine 1 (BCA-1) or B-lymphocyte chemoattractant (BLC), is a small cytokine belonging to the CXC chemokine family. It was independently discovered by two research groups in 1998-Legler et al. identified it as BCA-1, while Gunn et al. described it as BLC. CXCL13 is primarily secreted by follicular dendritic cells (FDCs) within B-cell follicles of secondary lymphoid organs, including lymph nodes, spleen, and Peyer's patches.