Home
Products
Primary Antibodies
Recombinant Antibodies
RAMP2 Recombinant monoclonal antibody (88020-3-RR)

RAMP2 Recombinant monoclonal antibody

RAMP2 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 88020-3-RR

Clone No. 260084E10

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Receptor activity-modifying protein 2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 88020-3-RR
Various lysates were subjected to SDS PAGE followed by western blot with 88020-3-RR (RAMP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse lung using 88020-3-RR
mouse lung tissue were subjected to SDS PAGE followed by western blot with 88020-3-RR (RAMP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of rat lung using 88020-3-RR
rat lung tissue were subjected to SDS PAGE followed by western blot with 88020-3-RR (RAMP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse lung using 88020-3-RR
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 88020-3-RR (RAMP2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAMP2 in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse lung tissue, mouse brain tissue, rat lung tissue, mouse heart tissue
Positive IHC detected in	mouse lung tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunohistochemistry (IHC)	IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

88020-3-RR targets RAMP2 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity	mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg9065 Product name: Recombinant Mouse RAMP2 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 45-157 aa of NM_019444.2 Sequence: SPESLNQSLPESQNQSHPTEDSLVSKGKMEDYETHVLPCWYEYKSCMDSVKDWCNWTLISRHYSDLQNCLEYNADKFGLGFPNPLAENIILEAHLIHFANCSLVQPTFSDPPE Predict reactive species
Full Name	receptor (calcitonin) activity modifying protein 2
Calculated Molecular Weight	21 kDa
Observed Molecular Weight	20-35kDa
GenBank Accession Number	NM_019444.2
Gene Symbol	Ramp2
Gene ID (NCBI)	54409
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q9WUP0
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAMP2 (receptor-activity-modifying protein) is a member of the RAMP family of single-transmembrane-domain proteins which consist of an N-terminal extracellular domain, a transmembrane region and a short intracellular C-terminal tail. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a G protein-coupled receptor, can function as either a calcitonin gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. RAMP1 transports the CRLR to the plasma membrane and then remains associated with it to function as a terminally glycosylated CGRP receptor, while RAMP2 and RAMP3 transfer the CRLR to the cell surface to generate receptors that are preferentially selective for adrenomedullin. (PMID: 9620797; 16188935)