SUB1 Recombinant monoclonal antibody

SUB1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 88052-1-RR

Clone No.260206C11

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Activated RNA polymerase II transcriptional coactivator p15, p14, P15, PC4, Positive cofactor 4

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWB

WB analysis using 88052-1-RR
Various lysates were subjected to SDS PAGE followed by western blot with 88052-1-RR (SUB1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in

A549 cells, K-562 cells, T-47D cells, PC-3 cells, HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

88052-1-RR targets SUB1 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag1390 Product name: Recombinant human SUB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC009610 Sequence: MPKSKELVSSGSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL Predict reactive species
Full Name	SUB1 homolog (S. cerevisiae)
Calculated Molecular Weight	14 kDa
Observed Molecular Weight	18-20 kDa
GenBank Accession Number	BC009610
Gene Symbol	SUB1
Gene ID (NCBI)	10923
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P53999
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SUB1 gene encodes activated RNA polymerase II transcriptional coactivator p15, also termed as positive cofactor 4 (PC4) or p14. SUB1 is a sort of general coactivator that functions in assembling and stablization of transcription complex. It has DNA binding activity and is localized in the nucleus, mulitple modification sites of phosphorylation or acetylation may turn it appear slightly shifted molecular weight.