Home
Products
Primary Antibodies
Recombinant Antibodies
Mouse CXCL10/IP-10 Recombinant monoclonal antibody, PBS Only (Capture/Detector) (88158-1-PBS)

Mouse CXCL10/IP-10 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

Name: Mouse CXCL10/IP-10 Recombinant monoclonal antibody, PBS Only (Capture/Detector), 100ug
Brand: Proteintech
SKU: 88158-1-PBS-100UG

CXCL10/IP-10 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 88158-1-PBS

Clone No. 253219D12

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

10 kDa interferon gamma-induced protein, C7, Crg2, C-X-C motif chemokine 10, Cxcl10

Formulation: PBS Only

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllSandwich ELISA sample testSandwich ELISACytometric bead array sample testCytometric bead array

Sandwich ELISA sample test of MP03346-2
RAW 264.7 were cultured unstimulated or stimulated with 1 ug/mL LPS for 3 days. The mean CXCL10/IP-10 concentration was determined to be 40.2 ng/mL in unstimulated supernatant, 223.85 ng/mL in LPS stimulated supernatant.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Sandwich ELISA sample test of MP03346-2
Serum of six mice was measured. The CXCL10/IP-10 concentration of detected samples was determined to be 10.66 ng/mL with a range of 2.04-18.64 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Sandwich ELISA standard curve of MP03346-2
Sandwich ELISA standard curve of MP03346-2, Mouse CXCL10/IP-10 Recombinant Matched Antibody Pair - PBS only. 88158-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg5063. 88158-2-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array sample test of MP03346-1
RAW 264.7 mouse monocyte/macrophage cells (3.5 x 106cells/mL) were cultured in DMEM supplemented with 8% fetal bovine serum, 2.5 mM L-glutamine, 100 U/mL penicillin, and 100 μg/mL streptomycin sulfate. Cells were cultured unstimulated or stimulated with 1 μg/mL LPS for 4 days. Aliquots of the cell culture supernates were removed and assayed for levels of mouse CXCL10/IP-10, and measured 15.6 ng/mL,124.5 ng/mL, respectively.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
RAW 264.7 mouse monocyte/macrophage cells (3.5 x 106cells/mL) were cultured in DMEM supplemented with 8% fetal bovine serum, 2.5 mM L-glutamine, 100 U/mL penicillin, and 100 μg/mL streptomycin sulfate. Cells were cultured unstimulated or stimulated with 1 μg/mL LPS for 4 days. Aliquots of the cell culture supernates were removed and assayed for levels of mouse CXCL10/IP-10, and measured 15.6 ng/mL,124.5 ng/mL, respectively.
Cytometric bead array standard curve of MP03346-1
Cytometric bead array standard curve of MP03346-1, MOUSE CXCL10/IP-10 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 88158-2-PBS. Detection antibody: 88158-1-PBS. Standard: Eg5063. Range: 0.781-100 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CXCL10/IP-10 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

88158-1-PBS targets CXCL10/IP-10 as part of a matched antibody pair:

MP03346-1: 88158-2-PBS capture and 88158-1-PBS detection (validated in Cytometric bead array)

MP03346-2: 88158-1-PBS capture and 88158-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg5063 Product name: Recombinant Mouse CXCL10/IP-10 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-98 aa of NM_021274.2 Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP Predict reactive species
Full Name	chemokine (C-X-C motif) ligand 10
Calculated Molecular Weight	11KD
GenBank Accession Number	NM_021274.2
Gene Symbol	Cxcl10
Gene ID (NCBI)	15945
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q548V9
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.