Use Able AI chat for product recommendations

DHX9 Recombinant monoclonal antibody

DHX9 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA

Cat No. 88165-1-RR
Clone No.260493F8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

ATP-dependent RNA helicase A, DDX9, DExH-box helicase 9, EC:3.6.4.13, LKP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, THP-1 cells, K-562 cells, HEK-293 cells, mouse testis tissue
Positive IHC detected inhuman skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

88165-1-RR targets DHX9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag12807

Product name: Recombinant human DHX9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-300 aa of BC014246

Sequence: MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPPLTDTPDTTANAEGDLPTTMGGPLPPHLALKAENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPP

Predict reactive species
Full Name DEAH (Asp-Glu-Ala-His) box polypeptide 9
Calculated Molecular Weight 1270 aa, 141 kDa
Observed Molecular Weight 140 kDa
GenBank Accession NumberBC014246
Gene Symbol DHX9
Gene ID (NCBI) 1660
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ08211
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RNA helicases play important roles in transcription, RNA processing, translation, and RNA replication. DEAD box proteins are putative RNA helicases that have a characteristic Asp-Glu-Ala-Asp (DEAD) box as 1 of 8 highly conserved sequence motifs. DHX9 a member of the DEAH family of proteins, which possess a double-stranded RNA-binding domain (dsRBD) and a helicase domain (PMID:20569003). It unwinds double-stranded DNA and RNA in a 3' to 5' direction. Alteration of secondary structure of DHX9 may subsequently influence interactions with proteins or other nucleic acids. It is also a component of the CRD-mediated complex that promotes MYC mRNA stability. In addition, it is involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2 (PMID: 19029303, 22190748).

Protocols

Product Specific Protocols
IHC protocol for DHX9 antibody 88165-1-RRDownload protocol
WB protocol for DHX9 antibody 88165-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...