Home
Products
Primary Antibodies
Recombinant Antibodies
S100P Recombinant monoclonal antibody, PBS Only (Capture) (88256-7-PBS)

S100P Recombinant monoclonal antibody, PBS Only (Capture)

Name: S100P Recombinant monoclonal antibody, PBS Only (Capture), 100ug
Brand: Proteintech
SKU: 88256-7-PBS-100UG

S100P Uni-rAb^® Recombinant Antibody for WB, IHC, Sandwich ELISA, Indirect ELISA

Cat No. 88256-7-PBS

Clone No.260786F1

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Sandwich ELISA, Indirect ELISA

Synonyms

Migration-inducing gene 9 protein, Protein S100 P, Protein S100-E, Protein S100-P, S100 calcium binding protein P

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBSandwich ELISA sample testSandwich ELISAIHC

WB analysis using 88256-7-RR (same clone as 88256-7-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 88256-7-RR (S100P antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88256-7-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Sandwich ELISA sample test of MP03518-2
The mean S100P concentration was determined to be 28.55 ng/mL in HeLa cell extract based on a 1.20 mg/mL extract load, 99.89 ng/mL in A549 cell extract based on a 1.20 mg/mL extract load, 9.63 ng/mL in Ramos cell extract based on a 1.20 mg/mL extract load, 13.25 ng/mL in HEK-293 cell extract based on a 1.20 mg/mL extract load and 12.60 ng/mL in SH-SY5Y cell extract based on a 1.20 mg/mL extract load.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
The mean S100P concentration was determined to be 28.55 ng/mL in HeLa cell extract based on a 1.20 mg/mL extract load, 99.89 ng/mL in A549 cell extract based on a 1.20 mg/mL extract load, 9.63 ng/mL in Ramos cell extract based on a 1.20 mg/mL extract load, 13.25 ng/mL in HEK-293 cell extract based on a 1.20 mg/mL extract load and 12.60 ng/mL in SH-SY5Y cell extract based on a 1.20 mg/mL extract load.
Sandwich ELISA sample test of MP03518-2
Serum of eight individual healthy human donors was measured. The S100P concentration of detected samples was determined to be 1.74 ng/mL with a range of 0.51-4.21 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Sandwich ELISA standard curve of MP03518-2
Sandwich ELISA standard curve of MP03518-2, Human S100P Recombinant Matched Antibody Pair - PBS only. 88256-7-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag2379. 88256-1-PBS was HRP conjugated as the detection antibody. Range: 0.391-25 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 88256-7-RR (same clone as 88256-7-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 88256-7-RR (S100P antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88256-7-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

88256-7-PBS targets S100P as part of a matched antibody pair:

MP03518-2: 88256-7-PBS capture and 88256-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag2379 Product name: Recombinant human S100P protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC006819 Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK Predict reactive species
Full Name	S100 calcium binding protein P
Calculated Molecular Weight	95 aa, 11 kDa
Observed Molecular Weight	11 kDa
GenBank Accession Number	BC006819
Gene Symbol	S100P
Gene ID (NCBI)	6286
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P25815
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

S100P protein is a relatively small (95 amino acid) isoform of the S100 protein family that was first isolated from human placenta. Overexpression of S100P has been detected in several cancers such as breast, colon, prostate, pancreatic and lung carcinomas, and the protein has been functionally implicated in carcinogenic processes. S100P protein is widely expressed in both normal and neoplastic tissues. It clearly shows ectopic expression in some cancers. Based on the high expression in certain tumors, S100P could represent a potential target for novel diagnostic and therapeutic applications.