Use Able AI chat for product recommendations

MAGOH Recombinant monoclonal antibody, PBS Only (Capture)

MAGOH Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 88341-1-PBS
Clone No.260941F11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

MAGOHA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

88341-1-PBS targets MAGOH as part of a matched antibody pair:

MP03492-1: 88341-1-PBS capture and 88341-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3004

Product name: Recombinant human MAGOH protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-146 aa of BC018211

Sequence: MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI

Predict reactive species
Full Name mago-nashi homolog, proliferation-associated (Drosophila)
Calculated Molecular Weight 146 aa, 17 kDa
Observed Molecular Weight 15-17 kDa
GenBank Accession NumberBC018211
Gene Symbol MAGOH
Gene ID (NCBI) 4116
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP61326
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MAGOH, belonging to the mago nashi family, is a component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Core components of the EJC functions to mark the position of the exon-exon junction in the mature mRNA and thereby influences downstream processes of gene expression including mRNA splicing, nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). MAGOH regulates the transcriptional activation of STAT3 by interfering complex formation between STAT3 and a core EJC component Y14.

Loading...
||
New chat

Able

正在加载,请稍候...