Tested Applications
| Positive WB detected in | mouse hippocampus tissue, mouse brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
88675-1-RR targets EAAT2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag19816 Product name: Recombinant human SLC1A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 460-574 aa of BC132768 Sequence: PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK Predict reactive species |
| Full Name | solute carrier family 1 (glial high affinity glutamate transporter), member 2 |
| Calculated Molecular Weight | 574 aa, 62 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC132768 |
| Gene Symbol | EAAT2 |
| Gene ID (NCBI) | 6506 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P43004 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
There are five isoforms of the EAATs, with their expression being cell type and brain region specific . The isoforms EAAT1 and EAAT2 are primarily expressed on astrocytes, with high expression in the cerebellum and throughout the entire brain, respectively. EAAT3 is expressed throughout the brain, while EAAT4 expression is predominantly found in the cerebellum. EAAT5 expression is mainly restricted to photoreceptors and bipolar cells in the retina. EAAT2, encoded by the SLC1A2 gene and also referred to by its rodent nomenclature, glutamate transporter 1 (GLT-1), is responsible for 90% of glutamate uptake in the mature brain. Its expression is hence critical for controlling extracellular glutamate concentrations.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for EAAT2 antibody 88675-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
