Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Mouse CD83 Rabbit Recombinant Antibody (98119-1-RR)

Anti-Mouse CD83 Rabbit Recombinant Antibody

CD83 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98119-1-RR

Clone No. 241002B7

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Synonyms

241002B7, CD83 antigen, mCD83

Formulation: PBS, Azide

PBS, Azide

PBS Only

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 647 CoraLite®594 FITC Plus

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFCAffinity

FC experiment of mouse splenocytes using 98119-1-RR
1x10^6 untreated or LPS-treated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD83 Rabbit Recombinant Antibody (98119-1-RR, Clone: 241002B7) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Cells were not fixed.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of mouse splenocytes using 98119-1-RR
1x10^6 LPS-treated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD83 Rabbit Recombinant Antibody (98119-1-RR, Clone: 241002B7) (red) or 0.25 ug Isotype Control (blue), and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD83 Rabbit Recombinant Antibody (98119-1-RR, Clone: 241002B7) (black, dashed), and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Cells were not fixed.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 LPS-treated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD83 Rabbit Recombinant Antibody (98119-1-RR, Clone: 241002B7) (red) or 0.25 ug Isotype Control (blue), and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD83 Rabbit Recombinant Antibody (98119-1-RR, Clone: 241002B7) (black, dashed), and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Cells were not fixed.
Affinity and Kinetic Characterization of 98119-1-RR
Biolayer interferometry (BLl) kinetic assays of 98119-1-RR against Mouse CD83 were performed. The affinity constant is 0.199 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD83 in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive FC detected in

LPS treated mouse splenocytes

Recommended dilution

Application	Dilution
Flow Cytometry (FC)	FC : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98119-1-RR targets CD83 in FC applications and shows reactivity with mouse samples.

Tested Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg1387 Product name: Recombinant Mouse CD83 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-133 aa of NM_009856.3 Sequence: MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYR Predict reactive species
Full Name	CD83 antigen
Calculated Molecular Weight	21 kDa
GenBank Accession Number	NM_009856.3
Gene Symbol	Cd83
Gene ID (NCBI)	12522
RRID	AB_3672266
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	O88324
Storage Buffer	PBS with 0.09% sodium azide, pH 7.3.
Storage Conditions	Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CD83 is a member of the immunoglobulin (Ig) superfamily, consisting of an extracellular V-type Ig-like domain, a transmembrane domain, and a cytoplasmic tail. CD83 is one of the most prominent markers for fully matured dendritic cells (DCs) (PMID: 17334966). It is also found on the surface of other activated hematopoietic cells, including lymphocytes, monocytes, macrophages, and neutrophils (PMID: 31231400; 17334966). CD83 regulates the maturation, activation, and homeostasis of numerous immune cells (PMID: 31231400; 32362900). CD83 can also expressed as a soluble form. Soluble CD83 can bind to DCs and inhibit their maturation (PMID: 17334966; 12403928).