Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Mouse ICOS/CD278 Rabbit Recombinant Antibody (98341-1-RR)

Anti-Mouse ICOS/CD278 Rabbit Recombinant Antibody

ICOS/CD278 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98341-1-RR

Clone No. 242639C3

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Synonyms

242639C3, Activation-inducible lymphocyte immunomediatory molecule, Ailim, CCLP, CD278

Formulation: PBS, Azide

PBS, Azide

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC

FC experiment of BALB/c spleen cells using 98341-1-RR
1x10^6 untreated or anti-CD3/CD28 treated BALB/c spleen cells were surface stained with 0.25 ug Anti-Mouse ICOS/CD278 Rabbit RecAb (98341-1-RR, Clone: 242639C3) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 488 Anti-Mouse CD3. Cells were not fixed.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of BALB/c spleen cells using 98341-1-RR
1x10^6 anti-CD3/CD28 treated BALB/c spleen cells were surface stained with 0.25 ug Anti-Mouse ICOS/CD278 Rabbit RecAb (98341-1-RR, Clone: 242639C3) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated BALB/c spleen cells were surface stained with 0.25 ug Anti-Mouse ICOS/CD278 Rabbit RecAb (98341-1-RR, Clone: 242639C3) (black, dashed) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 anti-CD3/CD28 treated BALB/c spleen cells were surface stained with 0.25 ug Anti-Mouse ICOS/CD278 Rabbit RecAb (98341-1-RR, Clone: 242639C3) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated BALB/c spleen cells were surface stained with 0.25 ug Anti-Mouse ICOS/CD278 Rabbit RecAb (98341-1-RR, Clone: 242639C3) (black, dashed) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

Able AI

What's the best dilution for ICOS/CD278 in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive FC detected in

Anti-CD3/CD28 treated BALB/c spleen cells

Recommended dilution

Application	Dilution
Flow Cytometry (FC)	FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98341-1-RR targets ICOS/CD278 in FC applications and shows reactivity with mouse samples.

Tested Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg3198 Product name: Recombinant Mouse ICOS/CD278 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-144 aa of NM_017480.2 Sequence: EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKLWL Predict reactive species
Full Name	inducible T-cell co-stimulator
Calculated Molecular Weight	23kDa
GenBank Accession Number	NM_017480.2
Gene Symbol	Icos
Gene ID (NCBI)	54167
RRID	AB_3745991
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q9WVS0
Storage Buffer	PBS with 0.09% sodium azide, pH 7.3.
Storage Conditions	Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Inducible T cell co-stimulator (ICOS) is related to the CD28 superfamily and is highly expressed on activated T cells as well as regulatory T cells and is crucial for the survival and function of T cells, Th2 cell differentiation, and lung inflammatory responses. Binding ICOS to ICOS-ligand (ICOS-L) activates a cascade of intracellular signaling molecules that prevent apoptosis and lead to the production of cytokines such as IL-4 and IL-13.