Tested Applications
| Positive IF-P detected in | rat brain tissue, mouse brain tissue, mouse cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-26975 targets NeuN in IF-P applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25689 Product name: Recombinant human NeuN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species |
| Full Name | hexaribonucleotide binding protein 3 |
| Observed Molecular Weight | 46-52 kDa |
| GenBank Accession Number | NM_001082575 |
| Gene Symbol | NeuN |
| Gene ID (NCBI) | 146713 |
| RRID | AB_2919210 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | A6NFN3 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Function
NeuN, also known as FOX3 or RBFOX3, belongs to a family of tissue-specific splicing regulators and is involved in neural circuitry balance, as well as neurogenesis and synaptogenesis (PMID: 26619789).
Tissue specificity
NeuN is exclusively present in post-mitotic neurons and is absent from neural progenitors, oligodendrocytes, astrocytes, and glia (PMID: 1483388).
Involvement in disease
· NeuN cytoplasmic localization is increased in the neurons of patients with HIV-associated neurocognitive disorders (PMID: 24215932).
Isoforms
There are 4 isoforms of NeuN, migrating in the 45-50 kDa range (PMID: 21747913).
Post-translational modifications
Currently not known.
Cellular localization
NeuN predominantly localizes to the nucleus but can also be present in the cytoplasm. Isoforms of NeuN differ in their cytoplasmic/nucleus localization (PMID: 21747913).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 NeuN antibody CL488-26975 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NeuN Polyclonal antibody (CL488-26975) has 2 citations. They appear in Experimental Neurology and Acta Biochimica et Biophysica Sinica (Shanghai). The research fields involve neuroinflammation and synaptic structural plasticity in postoperative cognitive dysfunction, and the inflammatory response in traumatic brain injury via the PGE2-EP2-cAMP-PKA signaling pathway.
| Species | Application | Title |
|---|---|---|
Exp Neurol Attenuation of postoperative cognitive dysfunction by Mongolian medical warm acupuncture associates with suppressed neuroinflammation and preserved synaptic structural plasticity. | ||
Acta Biochim Biophys Sin (Shanghai) Cannabidiol alleviates the inflammatory response in rats with traumatic brain injury through the PGE 2-EP2-cAMP-PKA signaling pathway |
