Tested Applications
| Positive WB detected in | HepG2 cells, HeLa cells, L02 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human colon cancer tissue, human brain tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10785-1-AP targets LDLR in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, chicken, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1236 Product name: Recombinant human LDLR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC014514 Sequence: MGPWGWKLRWTVALLLAAAGTAVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQR Predict reactive species |
| Full Name | low density lipoprotein receptor |
| Calculated Molecular Weight | 95 kDa |
| Observed Molecular Weight | 100-160 kDa |
| GenBank Accession Number | BC014514 |
| Gene Symbol | LDLR |
| Gene ID (NCBI) | 3949 |
| ENSEMBL Gene ID | ENSG00000130164 |
| RRID | AB_2281164 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01130 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LDLR (low density lipoprotein receptor) is a member of the LDL receptor gene family and is involved in receptor-mediated endocytosis of specific ligands. The LDLR is a cell surface glycoprotein that scavenges LDL from the blood and regulates plasma LDL cholesterol. The cytoplasmic domain of the LDL receptor is necessary for the receptor to cluster in coated pits, which promotes the rapid endocytosis of bound LDL. The protein is highly glycosylated through N- and O-linkages and thus migrates at 100 to 160 kDa bands on SDS-PAGE.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LDLR antibody 10785-1-AP | Download protocol |
| IHC protocol for LDLR antibody 10785-1-AP | Download protocol |
| IP protocol for LDLR antibody 10785-1-AP | Download protocol |
| WB protocol for LDLR antibody 10785-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-LDLR antibody (cat# 10785-1-AP) has 159 total citations published in journals including Cell, Nature Communications, Nature Biotechnology, Nature Nanotechnology, Cell Metabolism, Molecular Cell, Science Translational Medicine, Journal of Clinical Investigation, EMBO Journal, and over 90 others. Associated research fields encompass cholesterol and lipid metabolism, atherosclerosis, cancer biology, neurodegeneration, viral entry, diabetes, liver disease, and cardiovascular disease. Primary applications are Western blot, immunofluorescence, and immunoprecipitation.
| Species | Application | Title |
|---|---|---|
Cell A commonly inherited human PCSK9 germline variant drives breast cancer metastasis via LRP1 receptor | ||
Mol Cancer Systemic immunosuppression limits NK cell therapy efficacy in pancreatic cancer. | ||
Reviews
What customers say
One reviewer (Katia M.) rated this product 5/5 stars. She used it for immunofluorescence on PFA-fixed mouse primary cells at a 1:250 dilution (Lot 75483) and reported a positive experience. The review was posted on September 11, 2025. Overall, the single review reflects satisfaction with the antibody's performance in IF applications on mouse cells.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Katia (Verified Customer) (09-11-2025) | Used for immunofluorescence on PFA-fixed mouse primary cells.
|
