Tested Applications
| Positive WB detected in | A431 cells, human liver tissue, human brain tissue, NIH/3T3 cells, HeLa cells, Raji cells, Jurkat cells, mouse brain tissue, mouse heart tissue, mouse kidney tissue, rat brain tissue, rat heart tissue, rat kidney tissue |
| Positive IP detected in | A431 cells |
| Positive IHC detected in | human liver cancer tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10787-1-AP targets Prohibitin in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1240 Product name: Recombinant human Prohibitin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-272 aa of BC013401 Sequence: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ Predict reactive species |
| Full Name | prohibitin |
| Calculated Molecular Weight | 30 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC013401 |
| Gene Symbol | Prohibitin |
| Gene ID (NCBI) | 5245 |
| RRID | AB_2164476 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35232 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Prohibitin, also known as PHB, a member of the Band-7 family of proteins, is widely distributed in bacteria, plants, yeast, protozoa and mammals and is important in cell proliferation, differentiation and apoptosis (PMID: 20840588 ). This protein localizes to the inner membrane of mitochondria, where it acts as a chaperone protein, and is also found in the nucleus, where it negatively regulates transcription (PMID: 18558096). Recent study confirmed that the expression and distribution of PHB, which is a nuclear matrix protein, affect the apoptosis of HaCaT cells and its co-localization with specific gene products connected with cell apoptosis (PMID: 24402549).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Prohibitin antibody 10787-1-AP | Download protocol |
| IHC protocol for Prohibitin antibody 10787-1-AP | Download protocol |
| IP protocol for Prohibitin antibody 10787-1-AP | Download protocol |
| WB protocol for Prohibitin antibody 10787-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Prohibitin antibody (Cat# 10787-1-AP) has 33 citations published in journals including Cell, EMBO J, Signal Transduction and Targeted Therapy, Autophagy, Hepatology, Cell Death & Differentiation, Genes & Development, and eLife. Research fields span mitochondrial biology, cancer (colorectal, breast, melanoma), liver disease, cardiovascular remodeling, neurodegeneration, nephropathy, ferroptosis, and reproductive biology.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Short-chain acyl-CoA dehydrogenase initiates mtDNA demethylation and leakage to fuel antitumor immunity in colorectal cancer. | ||
Autophagy PHB2 (prohibitin 2) promotes PINK1-PRKN/Parkin-dependent mitophagy by the PARL-PGAM5-PINK1 axis. | ||
Hepatology Loss of Sam50 in hepatocytes induces cardiolipin-dependent mitochondrial membrane remodeling to trigger mtDNA release and liver injury | ||
Redox Biol A novel small-molecule inhibitor TD6 targets prohibitin 1 (PHB1) and suppresses colorectal cancer pulmonary metastasis by destabilizing mitochondrial complex I. | ||
Cell Death Differ Mic60/Mitofilin determines MICOS assembly essential for mitochondrial dynamics and mtDNA nucleoid organization. |
Reviews
What customers say
Both reviewers gave this product a 5-star rating. One user reported successful immunofluorescence staining of mouse primary lymphocytes, noting clear mitochondrial localization. The other used it for Western Blot on HEK293T whole cell lysate at a 1:1000 dilution, with membranes blocked in 5% BSA for one hour followed by overnight incubation at 4°C. Overall, users find the antibody reliable across different applications and cell types.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sara (Verified Customer) (10-10-2024) | It works well in immunofluorescence using mouse primary lymphocytes. It localises to the mitochondria.
 |
Tom (Verified Customer) (02-24-2021) | HEK293T whole cell lysate. Membrane was blocked in 5% BSA for 1 hour then incubated overnight at 4 degrees with the primary antibody (1:1000)
 |
