Tested Applications
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL647-11648 targets 14-3-3 Epsilon in FC (Intra) applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2247 Product name: Recombinant human 14-3-3E protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC000179 Sequence: MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ Predict reactive species |
| Full Name | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide |
| Calculated Molecular Weight | 255 aa, 29 kDa |
| Observed Molecular Weight | 29-32 kDa |
| GenBank Accession Number | BC000179 |
| Gene Symbol | 14-3-3E |
| Gene ID (NCBI) | 7531 |
| RRID | AB_2934861 |
| Conjugate | CoraLite® Plus 647 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62258 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
14-3-3 Epsilon (also known as YWHAE) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. This antibody was raised against full-length 14-3-3 Epsilon.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 647 14-3-3 Epsilon antibody CL647-11648 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

