14-3-3E Monoclonal antibody, PBS Only

• 

  WB analysis using 66946-1-Ig (same clone as 66946-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66946-1-Ig (14-3-3E antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66946-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 66946-1-Ig (same clone as 66946-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 66946-1-Ig (14-3-3E antibody) at dilution of 1:1 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66946-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 66946-1-Ig (same clone as 66946-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 66946-1-Ig (14-3-3E antibody) at dilution of 1:1 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66946-1-PBS in a different storage buffer formulation.

14-3-3E Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66946-1-PBS

Clone No.3A3A4

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

14-3-3 epsilon, YWHAE, 14-3-3 protein epsilon, 14-3-3epsilon

---

Product Information

66946-1-PBS targets 14-3-3E in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25186

  Product name: Recombinant human 14-3-3E protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-255 aa of BC000179

  Sequence: MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ

• Full Name: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide
• Calculated Molecular Weight: 255 aa, 29 kDa
• Observed Molecular Weight: 28-32 kDa
• GenBank Accession Number: BC000179
• Gene Symbol: 14-3-3E
• Gene ID (NCBI): 7531
• RRID: AB_2882270
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P62258
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

14-3-3 epsilon (also known as YWHAE) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis.