Tested Applications
| Positive WB detected in | mouse brain tissue, NCCIT cells, rat brain tissue, mouse embryo tissue |
| Positive IF/ICC detected in | human embronic stem cells |
| Positive FC (Intra) detected in | NCCIT cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 215 publications below |
| IHC | See 27 publications below |
| IF | See 111 publications below |
Product Information
14295-1-AP targets Nanog in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, marmoset |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5645 Product name: Recombinant human NANOG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-305 aa of BC160187 Sequence: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV Predict reactive species |
| Full Name | Nanog homeobox |
| Calculated Molecular Weight | 35 kDa |
| Observed Molecular Weight | 35-40 kDa |
| GenBank Accession Number | BC160187 |
| Gene Symbol | Nanog |
| Gene ID (NCBI) | 79923 |
| RRID | AB_1607719 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H9S0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nanog is a member of the homeobox family of DNA binding transcription factors and has been shown to maintain embryonic stem (ES) cell self-renewal independently of leukemia inhibitory factor (LIF)/Stat3. Nanog mRNA is present in pluripotent mouse and human cell lines, and absent from differentiated cells. Functionally, Nanog works together with other key pluripotent factors (Oct4, Sox2, and Lin28) to reprogram human fibroblasts and generate induced pluripotent stem (iPS) cells. These key factors form a regulatory network to support or limit each other's expression level, which maintains the properties of ES cells. Affinity purified rabbit anti-Nanog can be used to demonstrate pluripotency of ES and IPS cells. There are two kinds of variants that can be recognized by NANOG, one is a normal form (~39 kDa), the other is a post-translation modified form (~48 kDa) (21136380 ). Nanog has two isoforms with molecular weights of 34.4 kDa and 31.9 kDa. (PMID: 21969378)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Nanog antibody 14295-1-AP | Download protocol |
| WB protocol for Nanog antibody 14295-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Stem Cell A combined cell and gene therapy approach for homotopic reconstruction of midbrain dopamine pathways using human pluripotent stem cells. | ||
Cell Stem Cell Decoding the temporal and regional specification of microglia in the developing human brain. | ||
Cell Stem Cell A cloaked human stem-cell-derived neural graft capable of functional integration and immune evasion in rodent models | ||
Mol Cancer Circular RNA circIPO11 drives self-renewal of liver cancer initiating cells via Hedgehog signaling. | ||
Mol Cell RNA Targets Ribogenesis Factor WDR43 to Chromatin for Transcription and Pluripotency Control. | ||
Nat Commun Klf4 glutamylation is required for cell reprogramming and early embryonic development in mice. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Claudia (Verified Customer) (03-06-2026) | this antibody works well in my mESCs at 20µg with an overnight incubation
|
FH Cristine (Verified Customer) (11-09-2025) | The NANOG antibody worked very well and with high specificity at the dilution of 1:50 after overnight incubation at 4oC in immunocytochemistry assays of human induced pluripotent stem cells.
|
FH Chunxu (Verified Customer) (05-27-2025) | This antibody works very well in WB and IF to determine the stemness either cancer stem cells or mouse embryonic stem cells.
|
FH Fatemeh (Verified Customer) (05-22-2023) | 50 ug of protein lysate was used for WB. Blot was blocked with 5% milk and incubated with 1-1000 primary antibody overnight at 4C.
|
FH Udesh (Verified Customer) (02-24-2023) | Worked well at 1:1000 in 5% BSA O/N at 4 degrees
![]() |
FH Ying (Verified Customer) (08-19-2019) | very good antibody.
|








