Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, human liver tissue, mouse brain tissue, mouse kidney tissue |
| Positive IP detected in | mouse kidney tissue |
| Positive IHC detected in | human ovary cancer tissue, human kidney tissue, human liver tissue, human ovary tissue, human skin tissue, rat ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16726-1-AP targets GCSH in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10174 Product name: Recombinant human GCSH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-173 aa of BC000790 Sequence: MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE Predict reactive species |
| Full Name | glycine cleavage system protein H (aminomethyl carrier) |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC000790 |
| Gene Symbol | GCSH |
| Gene ID (NCBI) | 2653 |
| RRID | AB_2247351 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23434 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GCSH(Glycine cleavage system H protein, mitochondrial) is a component of the glycine cleavage system loosely associated with the mitochondrial inner membrane and has lipoic acid as a prosthetic group. The full-length GCSH cDNA encodes a precursor protein of 173 amino acids and a mature protein of 125 amino acids. The lipoylation of H-protein occurs in mitochondria which probably contain an activated form of lipoic acid as well as other components required for the transfer of lipoic acid to the protein(PMID:2211640). Defects in GCSH are a cause of non-ketotic hyperglycinemia (NKH).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GCSH antibody 16726-1-AP | Download protocol |
| IHC protocol for GCSH antibody 16726-1-AP | Download protocol |
| IP protocol for GCSH antibody 16726-1-AP | Download protocol |
| WB protocol for GCSH antibody 16726-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GCSH antibody (Cat# 16726-1-AP) has 20 citations across journals including Science, Nature Communications, Science Translational Medicine, Science Advances, Redox Biology, Free Radical Biology and Medicine, Journal of Biological Chemistry, Scientific Reports, Imeta, and others. Research fields span cuproptosis, glycine metabolism, mitochondrial disease, protein lipoylation, iron-sulfur cluster biology, metabolic reprogramming, and multiple cancer types (gastric, breast, colorectal, myeloma). Applications include WB, IHC, IF, IP, and CoIP.
| Species | Application | Title |
|---|---|---|
Imeta Clinical features and molecular landscape of cuproptosis signature-related molecular subtype in gastric cancer | ||
Nat Commun Blocking glycine utilization inhibits multiple myeloma progression by disrupting glutathione balance.
| ||
Redox Biol Iron overload exaggerates renal ischemia-reperfusion injury by promoting tubular cuproptosis via interrupting function of LIAS | ||
Sci Transl Med Aberrant methylmalonylation underlies methylmalonic acidemia and is attenuated by an engineered sirtuin | ||
Sci Adv Targeting multiple genetic defects of mitochondrial diseases with a single bacterial lipoate protein ligase. |
Reviews
What customers say
All three reviewers used this antibody for Western Blot and reported positive results. Two reviewers rated it 5 stars and one rated it 4 stars. Users at a 1:1000 dilution described the antibody as working great with clean blots. One reviewer specifically tested it on cancer cell lines and was satisfied with the performance. Overall, the feedback is consistently favorable, with no negative comments or issues raised.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Casey (Verified Customer) (12-01-2025) | Antibody worked great. Blot was clean.
|
Haley (Verified Customer) (11-25-2025) | Great antibody
|
Diana (Verified Customer) (11-03-2025) |
|
