Tested Applications
| Positive WB detected in | mouse brain tissue, mouse cerebellum tissue, PC-12 cells, SH-SY5Y cells, rat brain tissue, rat cerebellum, C6 cells |
| Positive IHC detected in | mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28205-1-AP targets BDNF in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28276 Product name: Recombinant human BDNF protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 129-247 aa of BC029795 Sequence: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR Predict reactive species |
| Full Name | brain-derived neurotrophic factor |
| Calculated Molecular Weight | 247 aa, 28 kDa |
| Observed Molecular Weight | 28-30 kDa |
| GenBank Accession Number | BC029795 |
| Gene Symbol | BDNF |
| Gene ID (NCBI) | 627 |
| RRID | AB_2818984 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23560 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
1) What is BDNF?
BDNF (brain-derived neurotrophic factor) is a small secreted growth factor that is important for the development and plasticity of the central nervous system and vital for long-term memory. Selected polymorphisms of BDNF have been shown to increase susceptibility to memory impairment and selected eating and mental disorders.
2) FAQs for BDNF
A) I can detect more than one band in my samples
BDNF is a neurotrophin that is a subject of maturation by proteolytic cleavage. The precursor protein (pre-proBDNF) is first cleaved to proBDNF (~34 kDa) by removing a signal peptide, and then to a mature form of BDNF (14 kDa). Additionally, (pre-)proBDNF can form dimers that run between 50 and 60 kDa, and a minor truncated form of proBDNF running at 28 kDa has also been reported (PMID: 11152678).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for BDNF antibody 28205-1-AP | Download protocol |
| WB protocol for BDNF antibody 28205-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The BDNF Polyclonal antibody (Cat# 28205-1-AP) has 227 total citations spanning over 80 journals, including Nature Communications, Advanced Materials, Oncogene, Journal of Neuroinflammation, Phytomedicine, Brain Research Bulletin, International Journal of Molecular Sciences, and Journal of Affective Disorders. Research fields predominantly cover neurodegeneration (Alzheimer's, Parkinson's), depression and mood disorders, neuroinflammation, stroke/brain injury, spinal cord injury, gut-brain axis, cognitive impairment, and neuropathic pain.
| Species | Application | Title |
|---|---|---|
Adv Mater Flexible Living Artificial Dura Mater for Efficient Therapy of Central Nervous System Injury Based on Neuronal Differentiation and Neuroprotective A2 Astrocyte Activation. | ||
Autophagy Trehalose induces autophagy via lysosomal-mediated TFEB activation in models of motoneuron degeneration. | ||
Nat Commun Migration of CD8 + TSCM cells into intestine via PPBP-CXCR2 axis increases host stress susceptibility by inhibiting gut microbiome-derived homovanillic acid. | ||
Redox Biol Design of anti-depressant phosphodiester amino acidic Keap1-Nrf2 protein-protein interaction inhibitors | ||
Theranostics Dopamine receptor 1 on CaMKII-positive neurons within claustrum mediates adolescent cocaine exposure-induced anxiety-like behaviors and electro-acupuncture therapy | ||
MedComm (2020) Enhanced effect of combining bone marrow mesenchymal stem cells (BMMSCs) and pulsed electromagnetic fields (PEMF) to promote recovery after spinal cord injury in mice |
Reviews
What customers say
Both reviewers gave 5-star ratings for Western Blot applications. One user tested it at 1:500 and 1:1000 dilutions on tumoral cells, endothelial cells, and mouse fibroblasts, reporting it worked well. The other used a 1:500 dilution on mouse brain tissue, also confirming good performance. Overall, customers report reliable results with this antibody in WB across multiple cell types and tissues.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Marine (Verified Customer) (07-01-2025) | This Ac worked well
|
Tanusree (Verified Customer) (12-18-2019) | Worked well in WB at 1:500 dilution.
|
